TRIOBP polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TRIOBP polyclonal antibody (Cat # PAB21237) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with TRIOBP polyclonal antibody (Cat # PAB21237) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TRIOBP polyclonal antibody (Cat # PAB21237) at 1-4 ug/mL dilution shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant TRIOBP.
Immunogen
Recombinant protein corresponding to amino acids of human TRIOBP.
Sequence
ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TRIOBP polyclonal antibody (Cat # PAB21237) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human rectum with TRIOBP polyclonal antibody (Cat # PAB21237) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TRIOBP polyclonal antibody (Cat # PAB21237) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — TRIOBP
Entrez GeneID
11078Protein Accession#
Q9H2D6Gene Name
TRIOBP
Gene Alias
DFNB28, FLJ39315, HRIHFB2122, KIAA1662, TARA, dJ37E16.4
Gene Description
TRIO and F-actin binding protein
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with F-actin and stabilizes F-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (NMD). [provided by RefSeq
Other Designations
OTTHUMP00000028958|tara-like protein|trio-associated repeat on actin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com