HNRNPH2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with HNRNPH2 polyclonal antibody (Cat # PAB20912) shows nuclear positivity in both glomeruli and renal tubules at 1:20-1:50 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant HNRNPH2.
Immunogen
Recombinant protein corresponding to amino acids of human HNRNPH2.
Sequence
FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with HNRNPH2 polyclonal antibody (Cat # PAB20912) shows nuclear positivity in both glomeruli and renal tubules at 1:20-1:50 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm. -
Gene Info — HNRNPH2
Entrez GeneID
3188Protein Accession#
P55795Gene Name
HNRNPH2
Gene Alias
FTP3, HNRPH', HNRPH2, hnRNPH'
Gene Description
heterogeneous nuclear ribonucleoprotein H2 (H')
Omim ID
300610Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that binds to RNAs. It is very similar to the family member HNRPH1. This gene is thought to be involved in Fabray disease and X-linked agammaglobulinemia phenotype. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000023682|heterogeneous nuclear ribonucleoprotein H-prime|heterogeneous nuclear ribonucleoprotein H2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com