Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CPOX polyclonal antibody

  • Catalog # : PAB20843
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant CPOX.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human CPOX.
  • Sequence:
  • QALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Western Blot (1:250-1:500)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human skeletal muscle with CPOX polyclonal antibody (Cat # PAB20843) shows strong cytoplasmic positivity in myocytes at 1:20-1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG with CPOX polyclonal antibody (Cat # PAB20843) at 1-4 ug/mL dilution shows positivity in cytoplasm, mitochondria.
  • Application Image
  • Western Blot
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1371
  • Gene Name:
  • CPOX
  • Gene Alias:
  • CPO,CPX,HCP
  • Gene Description:
  • coproporphyrinogen oxidase
  • Gene Summary:
  • Coproporphyrinogen oxidase (EC 1.3.3.3) is the sixth enzyme of the heme biosynthetic pathway. This soluble protein is localized in the intermembrane space of mitochondria and catalyzes the stepwise oxidative decarboxylation of the heme precursor coproporphyrinogen III to protoporphyrinogen IX via the tricarboxylic intermediate harderoporphyrinogen.[supplied by OMIM
  • Other Designations:
  • coproporphyrinogen oxidase (coproporphyria, harderoporphyria)
  • RSS
  • YouTube
  • Linkedin
  • Facebook