B4GALNT2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with B4GALNT2 polyclonal antibody (Cat # PAB20841) shows strong cytoplasmic positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant B4GALNT2.
Immunogen
Recombinant protein corresponding to amino acids of human B4GALNT2.
Sequence
LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with B4GALNT2 polyclonal antibody (Cat # PAB20841) shows strong cytoplasmic positivity in glandular cells. -
Gene Info — B4GALNT2
Entrez GeneID
124872Protein Accession#
Q8NHY0Gene Name
B4GALNT2
Gene Alias
B4GALGT2, B4GALT, Cad, GALGT2, MGC142235, MGC142237, SD, Sda
Gene Description
beta-1,4-N-acetyl-galactosaminyl transferase 2
Omim ID
111730Gene Ontology
HyperlinkGene Summary
B4GALNT2 catalyzes the last step in the biosynthesis of the human Sd(a) antigen through the addition of an N-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4GALNT2 also catalyzes the last step in the biosynthesis of the Cad antigen (Montiel et al., 2003 [PubMed 12678917]).[supplied by OMIM
Other Designations
Sda beta1,4GalNAc transferase|UDP-GalNAc:Neu5Acalpha2-3Galbeta-R beta1,4-N-acetylgalactosaminyltransferase|beta 1,4 N-acetylgalactosaminyltransferase|betal,4 GalNAcT/Sda-GalNAcT|other literature symbol GALGT2
-
Interactome
-
Disease
-
Publication Reference
-
A first-in-human phase I/IIa gene transfer clinical trial for Duchenne muscular dystrophy using rAAVrh74.MCK. GALGT2.
Kevin M Flanigan, Tatyana A Vetter, Tabatha R Simmons, Megan Iammarino, Emma C Frair, Federica Rinaldi, Louis G Chicoine, Johan Harris, John P Cheatham, Sharon L Cheatham, Brian Boe, Megan A Waldrop, Deborah A Zygmunt, Davin Packer, Paul T Martin.
Molecular Therapy. Methods & Clinical Development 2022 Dec; 27:47.
Application：WB-Ti, Human, Human muscle.
-
Soluble Heparin Binding EGF-like Growth Factor (HB-EGF) is a regulator of GALGT2 expression and GALGT2-dependent muscle and neuromuscular phenotypes.
Cramer ML, Xu R, Martin PT.
Molecular and Cellular Biology 2019 Jun; 39(14):e00140.
Application：IF, Mouse, CHO cells.
-
B4GALNT2 (GALGT2) Gene Therapy Reduces Skeletal Muscle Pathology in the FKRP P448L Mouse Model of Limb Girdle Muscular Dystrophy 2I.
Thomas PJ, Xu R, Martin PT.
The American Journal of Pathology 2016 Sep; 186(9):2429.
Application：WB-Ti, Mouse, Mouse muscle tissue.
-
A first-in-human phase I/IIa gene transfer clinical trial for Duchenne muscular dystrophy using rAAVrh74.MCK. GALGT2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com