Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HADHA polyclonal antibody

  • Catalog # : PAB20813
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant HADHA.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human HADHA.
  • Sequence:
  • IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Western Blot (1:250-1:500)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of cell lysates with HADHA polyclonal antibody (Cat # PAB20813) at 1:250-1:500 dilution.
    Lane 1 : NIH/3T3
    Lane 2 : NBT-II
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HADHA polyclonal antibody (Cat # PAB20813) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human small intestine with HADHA polyclonal antibody (Cat # PAB20813) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS with HADHA polyclonal antibody (Cat # PAB20813) at 1-4 ug/mL dilution shows positivity in mitochondria.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3030
  • Gene Name:
  • HADHA
  • Gene Alias:
  • ECHA,GBP,HADH,LCHAD,MGC1728,MTPA,TP-ALPHA
  • Gene Description:
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
  • Gene Summary:
  • This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. [provided by RefSeq
  • Other Designations:
  • 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit,3-oxoacyl-CoA thiolase,78 kDa gastrin-binding protein,OTTHUMP00000122457,mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit,mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (Co
  • RSS
  • YouTube
  • Linkedin
  • Facebook