RNF130 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RNF130 polyclonal antibody (Cat # PAB20735) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with RNF130 polyclonal antibody (Cat # PAB20735) shows strong cytoplasmic positivity in cells in tubules at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with RNF130 polyclonal antibody (Cat # PAB20735) at 1-4 ug/mL dilution shows positivity in nucleus, cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RNF130.
Immunogen
Recombinant protein corresponding to amino acids of human RNF130.
Sequence
PWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RNF130 polyclonal antibody (Cat # PAB20735) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with RNF130 polyclonal antibody (Cat # PAB20735) shows strong cytoplasmic positivity in cells in tubules at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with RNF130 polyclonal antibody (Cat # PAB20735) at 1-4 ug/mL dilution shows positivity in nucleus, cytoplasm. -
Gene Info — RNF130
Entrez GeneID
55819Protein Accession#
Q86XS8Gene Name
RNF130
Gene Alias
G1RZFP, GOLIATH, GP, MGC117241, MGC138647, MGC99542
Gene Description
ring finger protein 130
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells. [provided by RefSeq
Other Designations
g1-related zinc finger protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com