SEC62 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SEC62 polyclonal antibody (Cat # PAB20693) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with SEC62 polyclonal antibody (Cat # PAB20693) shows moderate cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SEC62 polyclonal antibody (Cat # PAB20693) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SEC62.
Immunogen
Recombinant protein corresponding to amino acids of human SEC62.
Sequence
GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SEC62 polyclonal antibody (Cat # PAB20693) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with SEC62 polyclonal antibody (Cat # PAB20693) shows moderate cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SEC62 polyclonal antibody (Cat # PAB20693) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum. -
Gene Info — SEC62
Entrez GeneID
7095Protein Accession#
Q99442Gene Name
SEC62
Gene Alias
Dtrp1, FLJ32803, HTP1, TLOC1, TP-1
Gene Description
SEC62 homolog (S. cerevisiae)
Omim ID
602173Gene Ontology
HyperlinkGene Summary
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq
Other Designations
membrane protein SEC62, S.cerevisiae, homolog of|translocation protein 1|translocation protein SEC62
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com