LILRB5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LILRB5 polyclonal antibody (Cat # PAB20582).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with LILRB5 polyclonal antibody (Cat # PAB20582) shows moderate cytoplasmic positivity in tubular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant LILRB5.
Immunogen
Recombinant protein corresponding to amino acids of human LILRB5.
Sequence
PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LILRB5 polyclonal antibody (Cat # PAB20582).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with LILRB5 polyclonal antibody (Cat # PAB20582) shows moderate cytoplasmic positivity in tubular cells. -
Gene Info — LILRB5
Entrez GeneID
10990Protein Accession#
O75023Gene Name
LILRB5
Gene Alias
CD85C, LIR-8, LIR8
Gene Description
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5
Omim ID
604814Gene Ontology
HyperlinkGene Summary
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). Several other LIR subfamily B receptors are expressed on immune cells where they bind to MHC class I molecules on antigen-presenting cells and inhibit stimulation of an immune response. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
leukocyte immunoglobulin-like receptor 8|leukocyte immunoglobulin-like receptor, subfamily B, member 5
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com