WBP5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with WBP5 polyclonal antibody (Cat # PAB20561).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with WBP5 polyclonal antibody (Cat # PAB20561) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant WBP5.
Immunogen
Recombinant protein corresponding to amino acids of human WBP5.
Sequence
EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with WBP5 polyclonal antibody (Cat # PAB20561).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with WBP5 polyclonal antibody (Cat # PAB20561) shows strong cytoplasmic positivity in exocrine glandular cells at 1:200-1:500 dilution. -
Gene Info — WBP5
Entrez GeneID
51186Protein Accession#
Q9UHQ7Gene Name
WBP5
Gene Alias
DKFZp313K1940, TCEAL9
Gene Description
WW domain binding protein 5
Gene Ontology
HyperlinkGene Summary
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq
Other Designations
OTTHUMP00000023739|OTTHUMP00000023740|WW domain binding protein 1|pp21 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com