FLII polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with FLII polyclonal antibody (Cat # PAB20459) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with FLII polyclonal antibody (Cat # PAB20459) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human liver with FLII polyclonal antibody (Cat # PAB20459) shows strong cytoplasmic positivity in hepatocytes at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with FLII polyclonal antibody (Cat # PAB20459) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant FLII.
Immunogen
Recombinant protein corresponding to amino acids of human FLII.
Sequence
YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with FLII polyclonal antibody (Cat # PAB20459) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with FLII polyclonal antibody (Cat # PAB20459) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human liver with FLII polyclonal antibody (Cat # PAB20459) shows strong cytoplasmic positivity in hepatocytes at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with FLII polyclonal antibody (Cat # PAB20459) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm. -
Gene Info — FLII
Entrez GeneID
2314Protein Accession#
Q13045Gene Name
FLII
Gene Alias
FLI, FLIL, Fli1, MGC39265
Gene Description
flightless I homolog (Drosophila)
Omim ID
600362Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
flightless I homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com