KANSL1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant KANSL1.
Immunogen
Recombinant protein corresponding to amino acids of human KANSL1.
Sequence
APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with KANSL1 polyclonal antibody (Cat # PAB20355) shows strong cytoplasmic and nuclear positivity in neuronal cells. -
Gene Info — KANSL1
Entrez GeneID
284058Protein Accession#
Q7Z3B3Gene Name
KANSL1
Gene Alias
CENP-36, KDVS, KIAA1267, MSL1v1, NSL1, hMSL1v1
Gene Description
KAT8 regulatory NSL complex subunit 1
Gene Ontology
HyperlinkOther Designations
MLL1/MLL complex subunit KANSL1; MSL1 homolog 1; NSL complex protein NSL1; centromere protein 36; male-specific lethal 1 homolog; non-specific lethal 1 homolog
-
Disease
-
Publication Reference
-
Kansl1 haploinsufficiency impairs autophagosome-lysosome fusion and links autophagic dysfunction with Koolen-de Vries syndrome in mice.
Ting Li, Dingyi Lu, Chengcheng Yao, Tingting Li, Hua Dong, Zhan Li, Guang Xu, Jiayi Chen, Hao Zhang, Xiaoyu Yi , Haizhen Zhu, Guangqin Liu, Kaiqing Wen, Haixin Zhao, Jun Gao, Yakun Zhang, Qiuying Han, Teng Li, Weina Zhang, Jie Zhao, Tao Li, Zhaofang Bai, Moshi Song, Xinhua He, Tao Zhou, Qing Xia, Ailing Li, Xin Pan.
Nature Communications 2022 Feb; 13(1):931.
Application:ChIP, WB-Ce, Human, HeLa cells.
-
NuMA recruits dynein activity to microtubule minus-ends at mitosis.
Hueschen CL, Kenny SJ, Xu K, Dumont S.
Elife 2017 Nov; 6:e2932.
Application:IF, WB, Human, RPE1 cells.
-
MOF Acetyl Transferase Regulates Transcription and Respiration in Mitochondria.
Aindrila Chatterjee, Janine Seyfferth, Jacopo Lucci, Ralf Gilsbach, Sebastian Preissl, Lena Böttinger, Christoph U Mårtensson, Amol Panhale, Thomas Stehle, Oliver Kretz, Abdullah H Sahyoun, Sergiy Avilov, Stefan Eimer, Lutz Hein, Nikolaus Pfanner, Thomas Becker, Asifa Akhtar.
Cell 2016 Oct; 167(3):722.
Application:WB-Ce, WB-Tr, Human, HeLa cells.
-
Kansl1 haploinsufficiency impairs autophagosome-lysosome fusion and links autophagic dysfunction with Koolen-de Vries syndrome in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com