PPP1R13B polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PPP1R13B.
Immunogen
Recombinant protein corresponding to amino acids of human PPP1R13B.
Sequence
PNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLEELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEAPSPGEEQVPPAPLPPASHPPATSTNK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with PPP1R13B polyclonal antibody (Cat # PAB20346) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PPP1R13B polyclonal antibody (Cat # PAB20346) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with PPP1R13B polyclonal antibody (Cat # PAB20346) shows strong nuclear and cytoplasmic positivity in neuronal cells, glial cells displayed nuclear staining.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with PPP1R13B polyclonal antibody (Cat # PAB20346) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm. -
Gene Info — PPP1R13B
Entrez GeneID
23368Protein Accession#
Q96KQ4Gene Name
PPP1R13B
Gene Alias
ASPP1, KIAA0771, p53BP2-like, p85
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 13B
Omim ID
606455Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor. [provided by RefSeq
Other Designations
apoptosis-stimulating protein of p53, 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com