HCFC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HCFC2 polyclonal antibody (Cat # PAB20343) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human adrenal gland with HCFC2 polyclonal antibody (Cat # PAB20343) shows strong cytoplasmic and membranous positivity in cortical cells at 1:50-1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant HCFC2.
Immunogen
Recombinant protein corresponding to amino acids of human HCFC2.
Sequence
APSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVGV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HCFC2 polyclonal antibody (Cat # PAB20343) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human adrenal gland with HCFC2 polyclonal antibody (Cat # PAB20343) shows strong cytoplasmic and membranous positivity in cortical cells at 1:50-1:200 dilution. -
Gene Info — HCFC2
Entrez GeneID
29915Protein Accession#
Q9Y5Z7Gene Name
HCFC2
Gene Alias
FLJ94012, HCF-2, HCF2
Gene Description
host cell factor C2
Omim ID
607926Gene Ontology
HyperlinkGene Summary
This gene encodes one of two proteins which interact with VP16, a herpes simplex virus protein that initiates virus infection. Both the encoded protein and the original Herpes host cell factor interact with VP16 through a beta-propeller domain. The original Herpes host cell factor, however, is effective at initiating viral infection while the encoded protein is not. Transcripts of varying length due to alternative polyadenylation signals have been described. [provided by RefSeq
Other Designations
host cell factor 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com