MTA2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with MTA2 polyclonal antibody (Cat # PAB20342) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with MTA2 polyclonal antibody (Cat # PAB20342) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with MTA2 polyclonal antibody (Cat # PAB20342) shows strong nuclear positivity in reaction center cells and lymphoid cells outside reaction center at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with MTA2 polyclonal antibody (Cat # PAB20342) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant MTA2.
Immunogen
Recombinant protein corresponding to amino acids of human MTA2.
Sequence
ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPT
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with MTA2 polyclonal antibody (Cat # PAB20342) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with MTA2 polyclonal antibody (Cat # PAB20342) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with MTA2 polyclonal antibody (Cat # PAB20342) shows strong nuclear positivity in reaction center cells and lymphoid cells outside reaction center at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with MTA2 polyclonal antibody (Cat # PAB20342) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli. -
Gene Info — MTA2
Entrez GeneID
9219Protein Accession#
O94776Gene Name
MTA2
Gene Alias
DKFZp686F2281, MTA1L1, PID
Gene Description
metastasis associated 1 family, member 2
Omim ID
603947Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacteylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis. [provided by RefSeq
Other Designations
metastasis -associated gene 1-like 1|metastasis associated gene family, member 2|metastasis-associated 1-like 1|metastasis-associated protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com