Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEC16A polyclonal antibody

  • Catalog # : PAB20311
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SEC16A.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SEC16A.
  • Sequence:
  • PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human pancreas with SEC16A polyclonal antibody (Cat # PAB20311) shows cytoplasmic positivity with a granular pattern in exocrine glandular cells at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9919
  • Gene Name:
  • SEC16A
  • Gene Alias:
  • FLJ26737,KIAA0310,RP11-413M3.10,SEC16L,p250
  • Gene Description:
  • SEC16 homolog A (S. cerevisiae)
  • Gene Summary:
  • The selective export of proteins and lipids from the endoplasmic reticulum (ER) is mediated by the coat protein complex II (COPII) that assembles at discrete sites on the membrane known as endoplasmic reticulum exit sites (ERES), or transitional ER sites. SEC16A is a peripheral membrane protein that defines ERES in mammalian cells and is required for protein transport from ER to Golgi (Watson et al., 2006 [PubMed 17005010]).
  • Other Designations:
  • SEC16 homolog A
  • RSS
  • YouTube
  • Linkedin
  • Facebook