Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2B3 polyclonal antibody

  • Catalog # : PAB20298
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant SH2B3.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SH2B3.
  • Sequence:
  • FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:20-1:50)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SH2B3 polyclonal antibody (Cat # PAB20298) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human lymph node with SH2B3 polyclonal antibody (Cat # PAB20298) shows strong nuclear membrane positivity in reaction center cells and lymphoid cells outside reaction center at 1:20-1:50 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • SH2B3
  • Gene Alias:
  • CELIAC13,LNK
  • Gene Description:
  • SH2B adaptor protein 3
  • Gene Summary:
  • T-cell activation requires stimulation of the T-cell receptor (TCR; see MIM 186880)-CD3 (see CD3Z; MIM 186780) complex, followed by recruitment of an array of intracellular signaling proteins (e.g., GRB2 (MIM 108355) and PLCG1 (MIM 172420)). Mediating the interaction between the extracellular receptors and intracellular signaling pathways are adaptor proteins such as LAT (MIM 602354), TRIM (MIM 604962), and LNK.[supplied by OMIM
  • Other Designations:
  • lymphocyte adaptor protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook