ARPC1B polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ARPC1B.
Immunogen
Recombinant protein corresponding to amino acids of human ARPC1B.
Sequence
TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with ARPC1B polyclonal antibody (Cat # PAB20284).
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ARPC1B polyclonal antibody (Cat # PAB20284).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with ARPC1B polyclonal antibody (Cat # PAB20284) shows strong cytoplasmic positivity in lymphoid cells outside reaction centra. -
Gene Info — ARPC1B
Entrez GeneID
10095Protein Accession#
O15143Gene Name
ARPC1B
Gene Alias
ARC41, p40-ARC, p41-ARC
Gene Description
actin related protein 2/3 complex, subunit 1B, 41kDa
Omim ID
604223Gene Ontology
HyperlinkGene Summary
This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. [provided by RefSeq
Other Designations
ARP2/3 protein complex subunit p41|actin related protein 2/3 complex subunit 1B|actin related protein 2/3 complex, subunit 1A (41 kD)|actin related protein 2/3 complex, subunit 1B (41 kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com