SMARCD1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with SMARCD1 polyclonal antibody (Cat # PAB20261) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SMARCD1 polyclonal antibody (Cat # PAB20261) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SMARCD1 polyclonal antibody (Cat # PAB20261) shows strong nuclear positivity in cells in seminiferus ducts at 1:50-1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SMARCD1.
Immunogen
Recombinant protein corresponding to amino acids of human SMARCD1.
Sequence
MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with SMARCD1 polyclonal antibody (Cat # PAB20261) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SMARCD1 polyclonal antibody (Cat # PAB20261) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SMARCD1 polyclonal antibody (Cat # PAB20261) shows strong nuclear positivity in cells in seminiferus ducts at 1:50-1:200 dilution. -
Gene Info — SMARCD1
Entrez GeneID
6602Protein Accession#
Q96GM5Gene Name
SMARCD1
Gene Alias
BAF60A, CRACD1, Rsc6p
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
Omim ID
601735Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000196567|OTTHUMP00000196568|SWI/SNF complex 60 kDa subunit A|SWI/SNF-related matrix-associated actin-dependent regulator of chromatin d1|Swp73-like protein|chromatin remodeling complex BAF60A subunit|mammalian chromatin remodeling complex BRG1-a
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com