BUB3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with BUB3 polyclonal antibody (Cat # PAB20227) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Liver, Lane 4: Tonsil with BUB3 polyclonal antibody (Cat # PAB20227) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with BUB3 polyclonal antibody (Cat # PAB20227) shows strong nuclear positivity in exocrine glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with BUB3 polyclonal antibody (Cat # PAB20227) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant BUB3.
Immunogen
Recombinant protein corresponding to amino acids of human BUB3.
Sequence
YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with BUB3 polyclonal antibody (Cat # PAB20227) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Liver, Lane 4: Tonsil with BUB3 polyclonal antibody (Cat # PAB20227) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with BUB3 polyclonal antibody (Cat # PAB20227) shows strong nuclear positivity in exocrine glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with BUB3 polyclonal antibody (Cat # PAB20227) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli. -
Gene Info — BUB3
Entrez GeneID
9184Protein Accession#
O43684Gene Name
BUB3
Gene Alias
BUB3L, hBUB3
Gene Description
budding uninhibited by benzimidazoles 3 homolog (yeast)
Omim ID
603719Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
BUB3 budding uninhibited by benzimidazoles 3 homolog|OTTHUMP00000020679|OTTHUMP00000020680|budding uninhibited by benomyl|budding uninhibited by benzimidazoles 3|mitotic checkpoint component
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com