Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DOCK8 polyclonal antibody

  • Catalog # : PAB20179
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant DOCK8.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human DOCK8.
  • Sequence:
  • AIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGSSDAPSS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).
    Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with DOCK8 polyclonal antibody (Cat # PAB20179).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human bone marrow with DOCK8 polyclonal antibody (Cat # PAB20179) shows moderate cytoplasmic positivity in bone marrow poietic cells.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • DOCK8
  • Gene Alias:
  • FLJ00026,FLJ00152,FLJ00346,MRD2,ZIR8
  • Gene Description:
  • dedicator of cytokinesis 8
  • Gene Summary:
  • DOCK8 is a member of the DOCK180-related (DOCK1; MIM 601403) protein family (Ruusala and Aspenstrom, 2004 [PubMed 15304341]).[supplied by OMIM
  • Other Designations:
  • 1200017A24Rik,OTTHUMP00000044124,OTTHUMP00000044125,OTTHUMP00000044308,OTTHUMP00000096442
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook