Product Browser

Last updated: 2016/9/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EBP polyclonal antibody

  • Catalog # : PAB20167
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant EBP.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human EBP.
  • Sequence:
  • YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:250-1:500)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with EBP polyclonal antibody (Cat # PAB20167) at 1:250-1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human testis with EBP polyclonal antibody (Cat # PAB20167) shows strong cytoplasmic positivity in Leydig cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG with EBP polyclonal antibody (Cat # PAB20167) at 1-4 ug/mL dilution shows positivity in endoplasmic reticulum.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • EBP
  • Gene Alias:
  • CDPX2,CHO2,CPX,CPXD
  • Gene Description:
  • emopamil binding protein (sterol isomerase)
  • Gene Summary:
  • The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). [provided by RefSeq
  • Other Designations:
  • 3-beta-hydroxysteroid-delta-8,delta-7-isomerase,Chondrodysplasia punctata-2, X-linked dominant (Happle syndrome),emopamil-binding protein (sterol isomerase),sterol 8-isomerase
  • RSS
  • YouTube
  • Linkedin
  • Facebook