PGRMC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PGRMC1.
Immunogen
Recombinant protein corresponding to amino acids of human PGRMC1.
Sequence
DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with PGRMC1 polyclonal antibody (Cat # PAB20135) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with PGRMC1 polyclonal antibody (Cat # PAB20135) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with PGRMC1 polyclonal antibody (Cat # PAB20135) shows strong cytoplasmic positivity in tubular cells at 1:500-1:1000 dilution. -
Gene Info — PGRMC1
Entrez GeneID
10857Protein Accession#
O00264Gene Name
PGRMC1
Gene Alias
HPR6.6, MPR
Gene Description
progesterone receptor membrane component 1
Omim ID
300435Gene Ontology
HyperlinkGene Summary
Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq
Other Designations
OTTHUMP00000023897|progesterone binding protein
-
Interactome
-
Disease
-
Publication Reference
-
Mifepristone Treatment Promotes Testicular Leydig Cell Tumor Progression in Transgenic Mice.
Donata Ponikwicka-Tyszko, Marcin Chrusciel, Kamila Pulawska, Piotr Bernaczyk, Maria Sztachelska, Peilan Guo, Xiangdong Li, Jorma Toppari, Ilpo T Huhtaniemi, Slawomir Wołczyński, Nafis A Rahman.
Cancers 2020 Nov; 12(11):E3263.
Application:ICC, IHC, Mouse, BLTK-1 cells, Mouse testicular tumor tissues.
-
Molecular mechanisms underlying mifepristone's agonistic action on ovarian cancer progression.
Ponikwicka-Tyszko D, Chrusciel M, Stelmaszewska J, Bernaczyk P, Chrusciel P, Sztachelska M, Scheinin M, Bidzinski M, Szamatowicz J, Huhtaniemi IT, Wolczynski S, Rahman NA.
EBioMedicine 2019 Sep; 47:170.
Application:IF, IHC-P, Human Mouse , HG-hOEC cells, Ovarian tumor tissues.
-
Progesterone receptor membrane component 1 as a potential prognostic biomarker for hepatocellular carcinoma.
Tsai HW, Ho CL, Cheng SW, Lin YJ, Chen CC, Cheng PN, Yen CJ, Chang TT, Chiang PM, Chan SH, Ho CH, Chen SH, Wang YW, Chow NH, Lin JC.
World Journal of Gastroenterology 2018 Mar; 24(10):1152.
Application:IHC-Fr, IHC-P, WB-Tr, Human, Hep3B, HepG2, Huh7 cells, Human hepatocellular carcinoma, PLC/PRF/5 cells.
-
Mifepristone Treatment Promotes Testicular Leydig Cell Tumor Progression in Transgenic Mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com