SSRP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SSRP1 polyclonal antibody (Cat # PAB20128) shows strong nuclear positivity in cells of seminiferus ducts at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SSRP1 polyclonal antibody (Cat # PAB20128) at 1-4 ug/mL dilution shows positivity in nucleus, cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SSRP1.
Immunogen
Recombinant protein corresponding to amino acids of human SSRP1.
Sequence
DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human testis with SSRP1 polyclonal antibody (Cat # PAB20128) shows strong nuclear positivity in cells of seminiferus ducts at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SSRP1 polyclonal antibody (Cat # PAB20128) at 1-4 ug/mL dilution shows positivity in nucleus, cytoplasm. -
Gene Info — SSRP1
Entrez GeneID
6749Protein Accession#
Q08945Gene Name
SSRP1
Gene Alias
FACT, FACT80, T160
Gene Description
structure specific recognition protein 1
Omim ID
604328Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. [provided by RefSeq
Other Designations
chromatin-specific transcription elongation factor 80 kDa subunit|cisplatin-DNA SSRP|facilitates chromatin remodeling 80 kDa subunit|high mobility group box|recombination signal sequence recognition protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com