RPL27 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with RPL27 polyclonal antibody (Cat # PAB20126).
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RPL27 polyclonal antibody (Cat # PAB20126).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with RPL27 polyclonal antibody (Cat # PAB20126) shows strong cytoplasmic positivity in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RPL27.
Immunogen
Recombinant protein corresponding to amino acids of human RPL27.
Sequence
GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with RPL27 polyclonal antibody (Cat # PAB20126).
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RPL27 polyclonal antibody (Cat # PAB20126).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with RPL27 polyclonal antibody (Cat # PAB20126) shows strong cytoplasmic positivity in glandular cells. -
Gene Info — RPL27
Entrez GeneID
6155Protein Accession#
P61353Gene Name
RPL27
Gene Alias
-
Gene Description
ribosomal protein L27
Omim ID
607526Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L27E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L27
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com