LMAN1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LMAN1 polyclonal antibody (Cat # PAB20116).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with LMAN1 polyclonal antibody (Cat # PAB20116) shows strong cytoplasmic positivity with granular pattern in glandular cells.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant LMAN1.
Immunogen
Recombinant protein corresponding to amino acids of human LMAN1.
Sequence
IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LMAN1 polyclonal antibody (Cat # PAB20116).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with LMAN1 polyclonal antibody (Cat # PAB20116) shows strong cytoplasmic positivity with granular pattern in glandular cells. -
Gene Info — LMAN1
Entrez GeneID
3998Protein Accession#
P49257Gene Name
LMAN1
Gene Alias
ERGIC-53, ERGIC53, F5F8D, FMFD1, MCFD1, MR60, gp58
Gene Description
lectin, mannose-binding, 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished. [provided by RefSeq
Other Designations
coagulation factor V-factor VIII combined deficiency|endoplasmic reticulum-golgi intermediate compartment protein 53|intracellular mannose specific lectin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com