ZNF234 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ZNF234 polyclonal antibody (Cat # PAB20078) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with ZNF234 polyclonal antibody (Cat # PAB20078) shows distinct nuclear and moderate cytoplasmic positivity in cells in tubules at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with ZNF234 polyclonal antibody (Cat # PAB20078) at 1-4 ug/mL dilution shows positivity in nuclei.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ZNF234.
Immunogen
Recombinant protein corresponding to amino acids of human ZNF234.
Sequence
DPVQRNLYQDVMLENFRNLLSVGHHPFKHDVFLLEKEKKLDIMKTATQRKGKSADKIQSEVETVPEAGRHEELYWGQIWKQIASDLIKYEDSMISISRFPRQGDLSCQVRAGLYTTHTGQK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with ZNF234 polyclonal antibody (Cat # PAB20078) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human kidney with ZNF234 polyclonal antibody (Cat # PAB20078) shows distinct nuclear and moderate cytoplasmic positivity in cells in tubules at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with ZNF234 polyclonal antibody (Cat # PAB20078) at 1-4 ug/mL dilution shows positivity in nuclei. -
Gene Info — ZNF234
Entrez GeneID
10780Protein Accession#
Q14588Gene Name
ZNF234
Gene Alias
HZF4, ZNF269
Gene Description
zinc finger protein 234
Omim ID
604750Gene Ontology
HyperlinkGene Summary
partial sequence|zinc finger protein 269
Other Designations
C2-H2 type zinc finger protein|Homo sapiens zinc finger 234|zinc finger protein 234, partial sequence|zinc finger protein 269
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com