CCDC50 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant CCDC50.
Immunogen
Recombinant protein corresponding to amino acids of human CCDC50.
Sequence
QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with CCDC50 polyclonal antibody (Cat # PAB20051) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with CCDC50 polyclonal antibody (Cat # PAB20051) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with CCDC50 polyclonal antibody (Cat # PAB20051) shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center at 1:1000-1:2500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with CCDC50 polyclonal antibody (Cat # PAB20051) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — CCDC50
Entrez GeneID
152137Protein Accession#
Q8IVM0Gene Name
CCDC50
Gene Alias
C3orf6, DFNA44, YMER
Gene Description
coiled-coil domain containing 50
Gene Ontology
HyperlinkGene Summary
This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
Ymer protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com