PSMA3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with PSMA3 polyclonal antibody (Cat # PAB20016).
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: U-138 MG, Lane 4: Liver, Lane 5: Tonsil with PSMA3 polyclonal antibody (Cat # PAB20016).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human heart muscle with PSMA3 polyclonal antibody (Cat # PAB20016) shows moderate cytoplasmic positivity in myocytes.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PSMA3.
Immunogen
Recombinant protein corresponding to amino acids of human PSMA3.
Sequence
FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with PSMA3 polyclonal antibody (Cat # PAB20016).
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: U-138 MG, Lane 4: Liver, Lane 5: Tonsil with PSMA3 polyclonal antibody (Cat # PAB20016).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human heart muscle with PSMA3 polyclonal antibody (Cat # PAB20016) shows moderate cytoplasmic positivity in myocytes. -
Gene Info — PSMA3
Entrez GeneID
5684Protein Accession#
P25788Gene Name
PSMA3
Gene Alias
HC8, MGC12306, MGC32631, PSC3
Gene Description
proteasome (prosome, macropain) subunit, alpha type, 3
Omim ID
176843Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
macropain subunit C8|multicatalytic endopeptidase complex subunit C8|proteasome alpha 3 subunit|proteasome subunit C8
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com