Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSTN polyclonal antibody

  • Catalog # : PAB19536
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against full length recombinant MSTN.
  • Immunogen:
  • Recombinant protein corresponding to full length human MSTN.
  • Sequence:
  • HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Purification:
  • Protein G purification
  • Purity:
  • >98%
  • Recommend Usage:
  • Western Blot (1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of recombinant MSTN protein (200 ng/lane) with MSTN polyclonal antibody (Cat # PAB19536) at 1:500 dilution.
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2660
  • Gene Name:
  • MSTN
  • Gene Alias:
  • GDF8
  • Gene Description:
  • myostatin
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth. [provided by RefSeq
  • Other Designations:
  • growth differentiation factor 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook