Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFB2 polyclonal antibody

  • Catalog # : PAB18937
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant TGFB2.
  • Immunogen:
  • Recombinant protein corresponding to human TGFB2.
  • Sequence:
  • ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Purification:
  • Protein G purification
  • Recommend Usage:
  • Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 100 uL distilled water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of 300 ng recombinant TGFB2 protein with TGFB2 polyclonal antibody (Cat # PAB18937) at 1 : 70 dilution.
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7042
  • Gene Name:
  • TGFB2
  • Gene Alias:
  • MGC116892,TGF-beta2
  • Gene Description:
  • transforming growth factor, beta 2
  • Other Designations:
  • OTTHUMP00000037528
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook