Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP7 polyclonal antibody

  • Catalog # : PAB18933
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant BMP7.
  • Immunogen:
  • Recombinant protein corresponding to human BMP7.
  • Sequence:
  • STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Purification:
  • Protein G purification
  • Recommend Usage:
  • Western Blot (1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 100 uL distilled water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of recombinant human BMP7 protein with BMP7 polyclonal antibody (Cat # PAB18933) at 1 : 500 dilution.
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 655
  • Gene Name:
  • BMP7
  • Gene Alias:
  • OP-1
  • Gene Description:
  • bone morphogenetic protein 7
  • Gene Summary:
  • The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031357,osteogenic protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook