Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEFB4 polyclonal antibody

  • Catalog # : PAB16646
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of DEFB4.
  • Immunogen:
  • A synthetic peptide (conjugated with Tg) corresponding to human DEFB4.
  • Sequence:
  • GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Recommend Usage:
  • ELISA (1:5000-1:100000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.0
  • Storage Instruction:
  • Store at 4°C on dry atmosphere.
    After reconstitution with distilled water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunohistochemistry
  • ELISA
  • Radioimmunoassay
  • Application Image
  • Immunohistochemistry
  • ELISA
  • Radioimmunoassay
  • Gene Information
  • Entrez GeneID:
  • 1673
  • Gene Name:
  • DEFB4
  • Gene Alias:
  • DEFB-2,DEFB102,DEFB2,HBD-2,SAP1
  • Gene Description:
  • defensin, beta 4
  • Gene Summary:
  • Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq
  • Other Designations:
  • defensin, beta 2,skin-antimicrobial peptide 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook