Myt1l polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Recombinant protein)
Western blot analysis bacterial lysate of MBP-fused antigen protein by using Myt1l polyclonal antibody (Cat. PAB15836).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Myt1l.
Immunogen
Recombinant GST fusion protein corresponding to 154 amino acids of mouse Myt1l.
Sequence
RATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX0194. This antibody detects mMYT1L protein.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Recombinant protein)
Western blot analysis bacterial lysate of MBP-fused antigen protein by using Myt1l polyclonal antibody (Cat. PAB15836). -
Gene Info — Myt1l
Entrez GeneID
17933Protein Accession#
AB093283Gene Name
Myt1l
Gene Alias
2900046C06Rik, 2900093J19Rik, C630034G21Rik, Nztf1, Pmng1, Png-1, mKIAA1106
Gene Description
myelin transcription factor 1-like
Gene Ontology
HyperlinkOther Designations
neural zinc finger protein NZF-1|neural zinc finger transcription factor 1|postmeiotic neural gene 1|zinc finger protein Png-1
-
Publication Reference
-
Generation of Patient-Specific Induced Neuronal Cells Using a Direct Reprogramming Strategy.
Wang P, Zhang HL, Li W, Sha H, Xu C, Yao L, Tang Q, Tang H, Chen L, Zhu J.
Stem Cells and Development 2014 Jan; 23(1):16.
Application：WB-Tr, Human, Induced neuronal cells.
-
Neutralization of terminal differentiation in gliomagenesis.
Hu J, Ho AL, Yuan L, Hu B, Hua S, Hwang SS, Zhang J, Hu T, Zheng H, Gan B, Wu G, Wang YA, Chin L, Depinho RA.
PNAS 2013 Sep; 110(36):14520.
Application：ChIP-Seq, IHC-Fr, IHC-P, Mouse, Mouse brains.
-
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H.
DNA Res 2003 Feb; 10(1):35.
-
Generation of Patient-Specific Induced Neuronal Cells Using a Direct Reprogramming Strategy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com