Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Myst4 polyclonal antibody

  • Catalog # : PAB15811
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Myst4.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 159 amino acids of mouse Myst4.
  • Sequence:
  • QLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRVNSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ
  • Host:
  • Rabbit
  • Reactivity:
  • Mouse
  • Specificity:
  • Specific to recombinant protein GX1056. This antibody detects mMYST4 protein.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of bacterial lysate of MBP-fused antigen protein with Myst4 polyclonal antibody (Cat # PAB15811).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • Myst4
  • Gene Alias:
  • AI507552,B130044K16Rik,KAT6B,Morf,mKIAA0383,qkf,querkopf
  • Gene Description:
  • MYST histone acetyltransferase monocytic leukemia 4
  • Other Designations:
  • histone acetyltransferase querkopf,monocytic leukemia
  • RSS
  • YouTube
  • Linkedin
  • Facebook