Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Scarf1 polyclonal antibody

  • Catalog # : PAB15803
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Scarf1.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 164 amino acids of mouse Scarf1.
  • Sequence:
  • PATSHGQLPPGSQMVAECAETTDGGIQESSGSVATIYMLAGTPQKPEGPVWSVFRRLGNYQK DQMDPKVKSAIPKPLRRSLGRNQASAGSAPGAVLSQAMESTAVRPEETPRGLGDGIESSGTVQ EPDAGGSSLEQDSQKQAEEKEQEEPLYENVVPMSVPPQH
  • Host:
  • Rabbit
  • Reactivity:
  • Mouse
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • Scarf1
  • Gene Alias:
  • AA986099,KIAA0149,MGC90792,SREC,SREC-I,mKIAA0149
  • Gene Description:
  • scavenger receptor class F, member 1
  • Other Designations:
  • OTTMUSP00000006503
  • RSS
  • YouTube
  • Linkedin
  • Facebook