Ralgapa1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Recombinant protein)
Western blot analysis of bacterial lysate of MBP-fused antigen protein with Ralgapa1 polyclonal antibody (Cat # PAB15730).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Ralgapa1.
Immunogen
Recombinant GST fusion protein corresponding to 158 mouse Ralgapa1.
Sequence
MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVDLGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Recombinant protein)
Western blot analysis of bacterial lysate of MBP-fused antigen protein with Ralgapa1 polyclonal antibody (Cat # PAB15730). -
Gene Info — Garnl1
Entrez GeneID
56784Protein Accession#
AK129236Gene Name
Garnl1
Gene Alias
2310003F20Rik, 4930400K19Rik, AI563624, GRIPE, Tulip1, mKIAA0884
Gene Description
GTPase activating RANGAP domain-like 1
Gene Ontology
HyperlinkOther Designations
GAP-related interacting partner to E12|tuberin-like protein 1|tulip 1 protein
-
Publication Reference
-
Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Noriko Okazaki, Reiko Kikuno, Reiko Ohara, Susumu Inamoto, Haruhiko Koseki, Shuichi Hiraoka, Yumiko Saga, Takahiro Nagase, Osamu Ohara, Hisashi Koga.
DNA Research 2003 Aug; 10(4):167.
-
Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com