Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Morc2a polyclonal antibody

  • Catalog # : PAB15729
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Morc2a.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 240 mouse Morc2a.
  • Sequence:
  • KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes human MORC2A protein.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • Morc2a
  • Gene Alias:
  • 8430403M08Rik,Zcwcc1
  • Gene Description:
  • microrchidia 2A
  • Other Designations:
  • zinc finger, CW-type with coiled-coil domain 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook