Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Dzip3 polyclonal antibody

  • Catalog # : PAB15723
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Dzip3.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 125 mouse Dzip3.
  • Sequence:
  • SEPLMINWERITDRLKTAFPQQTRKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSESEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDMVRPNLLTVNTFRSERKRMV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • Specific to recombinant protein GX0307. This antibody detects mDZIP3 protein. It also recognizes human DZIP3 protein.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • Dzip3
  • Gene Alias:
  • 2310047C04Rik,2A-HUB,6430549P11Rik,A230104G20
  • Gene Description:
  • DAZ interacting protein 3, zinc finger
  • Other Designations:
  • E3 ubiquitin-protein ligase DZIP3
  • RSS
  • YouTube
  • Linkedin
  • Facebook