Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Rb1cc1 polyclonal antibody

  • Catalog # : PAB15711
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Rb1cc1.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 117 mouse Rb1cc1.
  • Sequence:
  • QRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
  • Host:
  • Rabbit
  • Reactivity:
  • Mouse
  • Specificity:
  • Specific to recombinant protein GX0378. This antibody detects mRB1CC1 protein.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of Rb1cc1 polyclonal antibody (Cat # PAB15711).
    Bacterial lysate of MBP-fused antigen protein (Rb1cc1, partial).
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Gene Information
  • Gene Name:
  • Rb1cc1
  • Gene Alias:
  • 2900055E04Rik,5930404L04Rik,Cc1,DRAGOU14,FIP200,LaXp180
  • Gene Description:
  • RB1-inducible coiled-coil 1
  • Other Designations:
  • 200 kDa FAK family kinase-interacting protein,coiled coil forming protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook