Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Scrib polyclonal antibody

  • Catalog # : PAB15708
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Scrib.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 143 mouse Scrib.
  • Sequence:
  • ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • Specific to recombinant protein GX0312. This antibody detects mSCRIB protein. It also recognizes human SCRIB protein.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Scrib polyclonal antibody (Cat # PAB15708).
    Lane 1 : Total lysate of HaloTag-fused Scrib expressed HEK293 cells (4 ug).
    Lane 2 : Control HEK293 cell lysate (4 ug).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • Scrib
  • Gene Alias:
  • AI118201,CRIB,Crc,KIAA0147,SCRIB1,Scrb1,mKIAA0147,vartul
  • Gene Description:
  • scribbled homolog (Drosophila)
  • Other Designations:
  • OTTMUSP00000023091,PDZ-domain protein scribble,circletail,scribble homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook