Scrib polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Scrib polyclonal antibody (Cat # PAB15708).
Lane 1 : Total lysate of HaloTag-fused Scrib expressed HEK293 cells (4 ug).
Lane 2 : Control HEK293 cell lysate (4 ug).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Scrib.
Immunogen
Recombinant GST fusion protein corresponding to 143 mouse Scrib.
Sequence
ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS
Host
Rabbit
Reactivity
Human
Specificity
Specific to recombinant protein GX0312. This antibody detects mSCRIB protein. It also recognizes human SCRIB protein.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Scrib polyclonal antibody (Cat # PAB15708).
Lane 1 : Total lysate of HaloTag-fused Scrib expressed HEK293 cells (4 ug).
Lane 2 : Control HEK293 cell lysate (4 ug). -
Gene Info — Scrib
Entrez GeneID
105782Protein Accession#
AK122211Gene Name
Scrib
Gene Alias
AI118201, CRIB, Crc, KIAA0147, SCRIB1, Scrb1, mKIAA0147, vartul
Gene Description
scribbled homolog (Drosophila)
Gene Ontology
HyperlinkOther Designations
OTTMUSP00000023091|PDZ-domain protein scribble|circletail|scribble homolog 1
-
Publication Reference
-
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H.
DNA Res 2003 Feb; 10(1):35.
-
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com