Gramd1b polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Gramd1b.
Immunogen
Recombinant GST fusion protein corresponding to 370 mouse Gramd1b.
Sequence
CEEIPIEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEVMEGDGSLEKELAIDNIIGEKIEIMAPVTSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETELTKTESTYLAEIHRQSPKEKASKSSAVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPDGFHL
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX0439. This antibody detects endogenous mGRAMD1B protein in cerebellar interneuron cells.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Immunohistochemistry
-
Gene Info — Gramd1b
-
Publication Reference
-
A genomic atlas of human adrenal and gonad development.
Del Valle I, Buonocore F, Duncan AJ, Lin L, Barenco M, Parnaik R, Shah S, Hubank M, Gerrelli D, Achermann JC.
Wellcome Open Research 2017 Apr; 2:25.
Application:IHC, Human, Human fetal adrenal gland, human fetal testis.
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Hisashi Koga, Shigeki Yuasa, Takahiro Nagase, Kiyo Shimada, Mihoko Nagano, Kazuhide Imai, Reiko Ohara, Daisuke Nakajima, Masatoshi Murakami, Makoto Kawai, Futaba Miki, Junji Magae, Susumu Inamoto, Noriko Okazaki, Osamu Ohara.
DNA Research 2004 Aug; 11(4):293.
-
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H.
DNA Research 2003 Jun; 10(3):129.
-
A genomic atlas of human adrenal and gonad development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com