Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Fnbp1 polyclonal antibody

  • Catalog # : PAB15703
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Fnbp1.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 144 mouse Fnbp1.
  • Sequence:
  • QRFNQEQWEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSLSSSKEGKPELRFGGKSRGKLWPFIKKNKLMSLLTSPHQ
  • Host:
  • Rabbit
  • Reactivity:
  • Mouse
  • Specificity:
  • Specific to recombinant protein GX0310. This antibody detects endogenous mFNBP1 protein in cerebellar bergmann glia cells.
  • Form:
  • Liquid
  • Recommend Usage:
  • The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Application Image
  • Immunohistochemistry
  • Gene Information
  • Gene Name:
  • Fnbp1
  • Gene Alias:
  • 1110057E06Rik,2210010H06Rik,FBP1,Fbp17
  • Gene Description:
  • formin binding protein 1
  • Other Designations:
  • OTTMUSP00000012683,formin binding protein 17
  • RSS
  • YouTube
  • Linkedin
  • Facebook