Kcnd2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Kcnd2 (Cerebellum, Granule cell).
Immunogen
Recombinant GST fusion protein corresponding to 187 mouse Kcnd2.
Sequence
YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GXD01. This antibody detects endogenous mKCND2 protein in cerebellar granule cells.
Form
Liquid
Recommend Usage
The optimal working dilution should be determined by the end user.
Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry
-
Gene Info — Kcnd2
-
Publication Reference
-
Mutations in the genes KCND2 and KCND3 encoding the ion channels Kv4.2 and Kv4.3, conducting the cardiac fast transient outward current (ITO,f), are not a frequent cause of long QT syndrome.
Frank-Hansen R, Larsen LA, Andersen P, Jespersgaard C, Christiansen M.
Clinica Chimica Acta 2005 Jan; 351(1-2):95.
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Hisashi Koga, Shigeki Yuasa, Takahiro Nagase, Kiyo Shimada, Mihoko Nagano, Kazuhide Imai, Reiko Ohara, Daisuke Nakajima, Masatoshi Murakami, Makoto Kawai, Futaba Miki, Junji Magae, Susumu Inamoto, Noriko Okazaki, Osamu Ohara.
DNA Research 2004 Aug; 11(4):293.
-
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H.
DNA Research 2003 Jun; 10(3):129.
-
Mutations in the genes KCND2 and KCND3 encoding the ion channels Kv4.2 and Kv4.3, conducting the cardiac fast transient outward current (ITO,f), are not a frequent cause of long QT syndrome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com