Klhl9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Klhl9.
Immunogen
Recombinant GST fusion protein corresponding to 185 mouse Klhl9.
Sequence
SEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX1017. This antibody detects endogenous mKLHL9 protein in several cell types.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
-
Gene Info — Klhl9
-
Publication Reference
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Hisashi Koga, Shigeki Yuasa, Takahiro Nagase, Kiyo Shimada, Mihoko Nagano, Kazuhide Imai, Reiko Ohara, Daisuke Nakajima, Masatoshi Murakami, Makoto Kawai, Futaba Miki, Junji Magae, Susumu Inamoto, Noriko Okazaki, Osamu Ohara.
DNA Research 2004 Aug; 11(4):293.
-
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H.
DNA Research 2003 Jun; 10(3):129.
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com