Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Klhl9 polyclonal antibody

  • Catalog # : PAB15695
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant Klhl9.
  • Immunogen:
  • Recombinant GST fusion protein corresponding to 185 mouse Klhl9.
  • Sequence:
  • SEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS
  • Host:
  • Rabbit
  • Reactivity:
  • Mouse
  • Specificity:
  • Specific to recombinant protein GX1017. This antibody detects endogenous mKLHL9 protein in several cell types.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (50% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • Klhl9
  • Gene Alias:
  • 8030469P05,C530050O22Rik,ENSMUSG00000070923,KIAA1354,mKIAA1354
  • Gene Description:
  • kelch-like 9 (Drosophila)
  • Other Designations:
  • OTTMUSP00000012100,kelch-like 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook