Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Agrp polyclonal antibody

  • Catalog # : PAB14305
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Guinea pig polyclonal antibody raised against synthetic peptide of Agrp.
  • Immunogen:
  • A synthetic peptide (conjugated with carrier protein) corresponding to amino acids 82-131 of mouse Agrp.
  • Sequence:
  • SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
  • Host:
  • Guinea pig
  • Reactivity:
  • Mouse, Sheep
  • Form:
  • Lyophilized
  • Recommend Usage:
  • Immunohistochemistry (1:2000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS
  • Storage Instruction:
  • Store at 4°C on dry atmosphere.
    After reconstitution with deionized water, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Immunohistochemistry (Frozen sections)
  • Immunohistochemistry (Frozen sections)
  • The cryostat section of the sheep hypothalamus was incubated in Agrp polyclonal antibody (Cat # PAB14305) at the dilution of 1 : 1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
  • Immunofluorescence
  • Immunofluorescence
  • Immunohistochemical detection of Agrp in the arcuate nucleus of rat brain using Agrp polyclonal antibody (Cat # PAB14305) incubated at the dilution of 1 : 1000 ~ 2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1 : 500) secondary antibody.
  • Application Image
  • Immunohistochemistry (Frozen sections)
  • Immunohistochemistry (Frozen sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • Agrp
  • Gene Alias:
  • Agrt,Art
  • Gene Description:
  • agouti related protein
  • Other Designations:
  • orexigenic neuropeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook