Agrp polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Frozen sections)
The cryostat section of the sheep hypothalamus was incubated in Agrp polyclonal antibody (Cat # PAB14305) at the dilution of 1 : 1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
Immunofluorescence
Immunohistochemical detection of Agrp in the arcuate nucleus of rat brain using Agrp polyclonal antibody (Cat # PAB14305) incubated at the dilution of 1 : 1000 ~ 2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1 : 500) secondary antibody.
-
Specification
Product Description
Guinea pig polyclonal antibody raised against synthetic peptide of Agrp.
Immunogen
A synthetic peptide (conjugated with carrier protein) corresponding to amino acids 82-131 of mouse Agrp.
Sequence
SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
Host
Guinea pig
Reactivity
Mouse, Sheep
Form
Lyophilized
Recommend Usage
Immunohistochemistry (1:2000)
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS
Storage Instruction
Store at 4°C on dry atmosphere.
After reconstitution with deionized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing. -
Applications
Immunohistochemistry (Frozen sections)
The cryostat section of the sheep hypothalamus was incubated in Agrp polyclonal antibody (Cat # PAB14305) at the dilution of 1 : 1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.Immunofluorescence
Immunohistochemical detection of Agrp in the arcuate nucleus of rat brain using Agrp polyclonal antibody (Cat # PAB14305) incubated at the dilution of 1 : 1000 ~ 2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1 : 500) secondary antibody. -
Gene Info — Agrp
-
Publication Reference
-
Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate.
Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL.
Neuroscience 2006 Dec; 143(4):975.
Application：IF, IHC-Fr, Monkey, Monkey coronal hypothalamic sections.
-
Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com