Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOD1 polyclonal antibody

  • Catalog # : PAB13791
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of NOD1.
  • Immunogen:
  • A synthetic peptide corresponding to amino acids 2-31 of human NOD1.
  • Sequence:
  • EEQGHSEMEIIPSESHPHIQLLKSNRELLV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • Recognizes Nod1.
  • Form:
  • Liquid
  • Recommend Usage:
  • Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Detection of NOD1 (human) in HEK 293T transfected cells with NOD1 polyclonal antibody (Cat # PAB13791). 10 ug per lane of total cell extracts from mock transfected HEK 293T cells (lane 1) or HEK 293T cells transfected with a plasmid coding for human NOD1 (lane 2).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NOD1
  • Gene Alias:
  • CARD4,CLR7.1,NLRC1
  • Gene Description:
  • nucleotide-binding oligomerization domain containing 1
  • Other Designations:
  • NLR family, CARD domain containing 1,caspase recruitment domain 4,caspase recruitment domain family, member 4,nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook