ATP1B1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP1B1 (P05026, 63 a.a. - 303 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Sequence
EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Host
Viruses
Theoretical MW (kDa)
29
Form
Liquid
Preparation Method
Baculovirus expression system
Purity
> 90% by SDS-PAGE
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
Specific activity is > 3000 pmol/min/ug, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25°C.
Quality Control Testing
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer
In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — ATP1B1
Entrez GeneID
481Protein Accession#
P05026Gene Name
ATP1B1
Gene Alias
ATP1B, MGC1798
Gene Description
ATPase, Na+/K+ transporting, beta 1 polypeptide
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
Beta 1-subunit of Na(+),K(+)-ATPase|Na+/K+ -ATPase beta 1 subunit|Na, K-ATPase beta-1 polypeptide|Na,K-ATPase beta 1 subunit|OTTHUMP00000032537|OTTHUMP00000032538|adenosinetriphosphatase|sodium/potassium-dependent ATPase beta-1 subunit|sodium/potassium-tr
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com