CST6 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CST6 (Q15828, 29 a.a. - 149 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Sequence
RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Host
Escherichia coli
Theoretical MW (kDa)
15.9
Form
Liquid
Preparation Method
Escherichia coli expression system
Purity
> 90% by SDS-PAGE
Activity
The IC50 value is < 20 nM, was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.
Quality Control Testing
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer
In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — CST6
Entrez GeneID
1474Protein Accession#
Q15828Gene Name
CST6
Gene Alias
-
Gene Description
cystatin E/M
Omim ID
601891Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. [provided by RefSeq
Other Designations
cystatin 6|cystatin M|cystatin M/E|cysteine proteinase inhibitor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com