CXCL11 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Host
Escherichia coli
Theoretical MW (kDa)
8.300000000000001
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 97% by SDS-PAGE
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The ED50 was determined by a chemotaxis bioassay using human IL-2 activated human T-lymphocytes is in a concentration range of 0.1 - 10 ng/mL.
Storage Buffer
Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Storage Instruction
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — CXCL11
Entrez GeneID
6373Protein Accession#
O14625Gene Name
CXCL11
Gene Alias
H174, I-TAC, IP-9, IP9, MGC102770, SCYB11, SCYB9B, b-R1
Gene Description
chemokine (C-X-C motif) ligand 11
Omim ID
604852Gene Ontology
HyperlinkGene Summary
Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq
Other Designations
small inducible cytokine B11|small inducible cytokine subfamily B (Cys-X-Cys), member 11|small inducible cytokine subfamily B (Cys-X-Cys), member 9B
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com