CD160 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD160 (O95971, 27 a.a. - 159 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Sequence
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Host
Mammals
Theoretical MW (kDa)
50
Form
Lyophilized
Preparation Method
Mammalian cell (HEK293) expression system
Purity
> 95% by SDS-PAGE
Endotoxin Level
< 1 EU per 1 ug of protein (determined by gel clotting method)
Activity
Immobilized CD160, hFc, Human at 1.0 ug/mL (100 uL/well) can bind HVEM-Fc, Human-Biotin with a liner range of 0.617 - 50.0 ug/mL when detected by SA-HRP.
Storage Buffer
Lyophilized from sterile distilled Water up to 100 ug/mL
Storage Instruction
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — CD160
Entrez GeneID
11126Protein Accession#
O95971Gene Name
CD160
Gene Alias
BY55, FLJ46513, NK1, NK28
Gene Description
CD160 molecule
Omim ID
604463Gene Ontology
HyperlinkGene Summary
CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq
Other Designations
CD160 antigen|OTTHUMP00000015585|natural killer cell receptor, immunoglobulin superfamily member
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com